DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT1G32250

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:147 Identity:44/147 - (29%)
Similarity:80/147 - (54%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFC 71
            |:||:..||..|::||.:..||:...::.|:|..||.|..|...:.||.:.|..:.|.::|.:|.
plant    10 DEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVEFPEFV 74

  Fly    72 KLAARFI--EVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            .|.:..:  ..:......:.:|...||::|.:|.|::|.|.|...:.:|...|:..:|..:|:|.
plant    75 ALVSPELLSPAKRTTPYTEEQLLRLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKEA 139

  Fly   135 DADGSGTVDFDEFMQVM 151
            |:||.|.::|.||.:.:
plant   140 DSDGDGRINFQEFAKAI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 44/147 (30%)
EFh 14..75 CDD:238008 20/60 (33%)
EFh 90..152 CDD:238008 21/62 (34%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 44/147 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.