DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT1G18530

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_173288.1 Gene:AT1G18530 / 838434 AraportID:AT1G18530 Length:157 Species:Arabidopsis thaliana


Alignment Length:145 Identity:41/145 - (28%)
Similarity:80/145 - (55%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            ::|:|.|::.|..||.|..||:...:::::|..||.|.....:..|:..:|....|   |.:|.:
plant     2 EDQIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSNGNG---FVEFDE 63

  Fly    73 LAARFI-EVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDA 136
            |....: ::.|:|.....:|.|.|:.:|::|.|:::.|.|.|.:.::...|:.::|..:|:|.|.
plant    64 LVGTILPDLNEEVLINSEQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADT 128

  Fly   137 DGSGTVDFDEFMQVM 151
            :|.|.:.|.||..:|
plant   129 NGDGVISFGEFASIM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 41/145 (28%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 20/62 (32%)
AT1G18530NP_173288.1 PTZ00184 2..143 CDD:185504 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.