powered by:
Protein Alignment TpnC4 and CALN1
DIOPT Version :9
Sequence 1: | NP_001163055.1 |
Gene: | TpnC4 / 35498 |
FlyBaseID: | FBgn0033027 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_113656.2 |
Gene: | CALN1 / 83698 |
HGNCID: | 13248 |
Length: | 261 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 29/74 - (39%) |
Similarity: | 45/74 - (60%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 IEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTV 142
|.||| .:|::|||||.|::|.|:::...|...:..|....|..:|.:|::.:|.||.|.|
Human 75 ISVEE-----LDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQV 134
Fly 143 DFDEFMQVM 151
||||||.::
Human 135 DFDEFMTIL 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165143669 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.