DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CALN1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_113656.2 Gene:CALN1 / 83698 HGNCID:13248 Length:261 Species:Homo sapiens


Alignment Length:74 Identity:29/74 - (39%)
Similarity:45/74 - (60%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTV 142
            |.|||     .:|::|||||.|::|.|:::...|...:..|....|..:|.:|::.:|.||.|.|
Human    75 ISVEE-----LDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQV 134

  Fly   143 DFDEFMQVM 151
            ||||||.::
Human   135 DFDEFMTIL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 29/74 (39%)
EFh 14..75 CDD:238008
EFh 90..152 CDD:238008 25/62 (40%)
CALN1NP_113656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
PTZ00184 74..>184 CDD:185504 29/74 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.