DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CEN2

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001031798.1 Gene:CEN2 / 829855 AraportID:AT4G37010 Length:171 Species:Arabidopsis thaliana


Alignment Length:143 Identity:42/143 - (29%)
Similarity:81/143 - (56%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73
            ::.|.:|..|..||.||:|||:.::::..:..||.::....:..|:.||||..:|.:||.:|..:
plant    27 QKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEFVHM 91

  Fly    74 AARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADG 138
            ........:.:    :||.:||::.|.:..|.::...::.|..||.:..::.|::.:|||.|.|.
plant    92 MTTKFGERDSI----DELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDK 152

  Fly   139 SGTVDFDEFMQVM 151
            .|.|:.:|||::|
plant   153 DGEVNLEEFMKMM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 42/143 (29%)
CEN2NP_001031798.1 PTZ00183 15..169 CDD:185503 42/143 (29%)

Return to query results.
Submit another query.