DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CAM9

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:151 Identity:39/151 - (25%)
Similarity:78/151 - (51%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKL 65
            |||. :..||::....||...|.|..|.|....::.:::.:|:..:...::.::.:||....|.:
plant     1 MADA-FTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGI 64

  Fly    66 DFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMI 130
            .|..|..:.|:....|    :..:||.|.|||:|::|.|.::...|...:.::..|::.::.:.:
plant    65 TFDDFLYIMAQNTSQE----SASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHM 125

  Fly   131 IEEIDADGSGTVDFDEFMQVM 151
            :.|.|.||.|.:.|.||.::|
plant   126 VREADLDGDGFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 39/151 (26%)
EFh 14..75 CDD:238008 12/60 (20%)
EFh 90..152 CDD:238008 20/62 (32%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 39/151 (26%)
EFh 12..74 CDD:238008 12/61 (20%)
EFh 85..146 CDD:238008 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.