DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT3G03000

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_186950.1 Gene:AT3G03000 / 821161 AraportID:AT3G03000 Length:165 Species:Arabidopsis thaliana


Alignment Length:154 Identity:53/154 - (34%)
Similarity:86/154 - (55%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLD 66
            |..:...|||..||..|::||.:..||:...::.|:|..||.|.....:..||::.|:...|.::
plant     9 APAKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKADRNNNGLVE 73

  Fly    67 FSQFCKLAARFIEVEEDV---GALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLD 128
            ||:|..|      ||.|:   ....::||..||::|::|.||:|.|.|...:.:|...|:.::|.
plant    74 FSEFVAL------VEPDLVKCPYTDDQLKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELT 132

  Fly   129 MIIEEIDADGSGTVDFDEFMQVMT 152
            .:|:|.|.||.|.:||.||:|.:|
plant   133 GMIKEADRDGDGCIDFQEFVQAIT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 52/152 (34%)
EFh 14..75 CDD:238008 20/60 (33%)
EFh 90..152 CDD:238008 25/61 (41%)
AT3G03000NP_186950.1 PTZ00184 10..157 CDD:185504 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.