DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and MSS3

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_565996.1 Gene:MSS3 / 818931 AraportID:AT2G43290 Length:215 Species:Arabidopsis thaliana


Alignment Length:144 Identity:45/144 - (31%)
Similarity:81/144 - (56%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKLAARFI 78
            |:..|:.||.:|.|.|...:::..||.||..:....:..:|.::|....|.:|..:|..|.:..:
plant    66 LKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDIDEFESLYSSIV 130

  Fly    79 EVEEDVGALQNE-LKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLD---MIIEEIDADGS 139
            :...:.|..:.| :|:||.|:|::|.|::||..|:.::..|..| ..:.||   .:|.::||||.
plant   131 DEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLK-QGKTLDGCKKMIMQVDADGD 194

  Fly   140 GTVDFDEFMQVMTG 153
            |.|::.||:|:|.|
plant   195 GRVNYKEFLQMMKG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 43/141 (30%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 25/65 (38%)
MSS3NP_565996.1 PTZ00184 64..206 CDD:185504 43/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.