DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT2G41090

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_181642.1 Gene:AT2G41090 / 818708 AraportID:AT2G41090 Length:191 Species:Arabidopsis thaliana


Alignment Length:147 Identity:38/147 - (25%)
Similarity:78/147 - (53%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            ::.::|:...|..|..:|.:|.|.|...:..:::..||..|....::..|.:.|....|.::|::
plant     4 KFTRQQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTE 68

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |....|:....|:|       ||:.||::|.:..|:::.|.:|.:...|..|.:::::|.||:..
plant    69 FLCAMAKDTYSEKD-------LKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAA 126

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.||.|.:::.||.::|
plant   127 DVDGDGQINYREFARLM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 38/147 (26%)
EFh 14..75 CDD:238008 14/60 (23%)
EFh 90..152 CDD:238008 20/62 (32%)
AT2G41090NP_181642.1 PTZ00184 1..146 CDD:185504 38/147 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.