DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT2G41090

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_181642.1 Gene:AT2G41090 / 818708 AraportID:AT2G41090 Length:191 Species:Arabidopsis thaliana


Alignment Length:147 Identity:38/147 - (25%)
Similarity:78/147 - (53%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            ::.::|:...|..|..:|.:|.|.|...:..:::..||..|....::..|.:.|....|.::|::
plant     4 KFTRQQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTE 68

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |....|:....|:|       ||:.||::|.:..|:::.|.:|.:...|..|.:::::|.||:..
plant    69 FLCAMAKDTYSEKD-------LKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAA 126

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.||.|.:::.||.::|
plant   127 DVDGDGQINYREFARLM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 38/147 (26%)
AT2G41090NP_181642.1 PTZ00184 1..146 CDD:185504 38/147 (26%)

Return to query results.
Submit another query.