DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CALM1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001350599.1 Gene:CALM1 / 801 HGNCID:1442 Length:150 Species:Homo sapiens


Alignment Length:152 Identity:54/152 - (35%)
Similarity:94/152 - (61%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKL 65
            |...:..:||:...:.||..||.||.|:|...::.:::..|||......::.:|.|||....|.:
Human     1 MQADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 65

  Fly    66 DFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMI 130
            ||.:|..:.||.::..:.    :.|::|||||:||:|.||::.|.||.::..|.:||:::::|.:
Human    66 DFPEFLTMMARKMKDTDS----EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEM 126

  Fly   131 IEEIDADGSGTVDFDEFMQVMT 152
            |.|.|.||.|.|:::||:|:||
Human   127 IREADIDGDGQVNYEEFVQMMT 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 52/150 (35%)
EFh 14..75 CDD:238008 19/60 (32%)
EFh 90..152 CDD:238008 28/61 (46%)
CALM1NP_001350599.1 PTZ00184 3..150 CDD:185504 53/150 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.