DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Efcab15

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001241653.1 Gene:Efcab15 / 69441 MGIID:1916691 Length:382 Species:Mus musculus


Alignment Length:61 Identity:14/61 - (22%)
Similarity:31/61 - (50%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQVMT 152
            ::.|:::.....|.:.:.:::..|.....:|..|::...:...|.||.|.|.|.:|:.|:|
Mouse   111 QDIFKLFSCSPTGTVDMQSMKIALRNAGIQLGPQEMCEALRLADLDGDGIVSFKDFLGVLT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 13/59 (22%)
Efcab15NP_001241653.1 PTZ00184 61..173 CDD:185504 14/61 (23%)
EF-hand_8 121..173 CDD:404678 13/51 (25%)
PTZ00449 <285..>369 CDD:185628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.