DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Myl6

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_008763261.1 Gene:Myl6 / 685867 RGDID:1589019 Length:152 Species:Rattus norvegicus


Alignment Length:146 Identity:36/146 - (24%)
Similarity:76/146 - (52%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIK-----EVDKGTTGK 64
            ::.::|....:.||:.||..|.|.|.::....::..|||.   |....::|     :.|:.....
  Rat     3 DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQN---PTNAEVLKVLGNPKSDEMNVKV 64

  Fly    65 LDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDM 129
            |||..|..: .:.:...:|.|..::.: |..||:||||.|.:..|.:|.:|..|.:|::.::::|
  Rat    65 LDFEHFLPM-LQTVAKNKDQGTYEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEM 127

  Fly   130 IIEEIDADGSGTVDFD 145
            ::...: |.:|.::::
  Rat   128 LVAGHE-DSNGCINYE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 36/146 (25%)
EFh 14..75 CDD:238008 17/65 (26%)
EFh 90..152 CDD:238008 16/56 (29%)
Myl6XP_008763261.1 PTZ00184 5..142 CDD:185504 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.