DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Efcab12

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_003749858.1 Gene:Efcab12 / 680899 RGDID:1586985 Length:675 Species:Rattus norvegicus


Alignment Length:155 Identity:34/155 - (21%)
Similarity:60/155 - (38%) Gaps:41/155 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGT--TGKLDFSQFC 71
            |..|::|:..|.||       :|.             .|..:...|:|:...|  ...|.:.|..
  Rat   459 ENCRLVRSGTKQFD-------DHC-------------LPTTISGEIEELLNMTRRDNFLVYLQCW 503

  Fly    72 KLAARF-IEVEEDV--------GALQNELKEAFRVYDKEGKGYL---TVATLRGI--LHELDDKL 122
            :|...: :.:.||:        |.....|||..|...:.|..|:   .|.:|.|.  ||:..:|.
  Rat   504 ELCEAYGLPLTEDILMRALLYPGDRIISLKEEVRPIRQPGGYYIDDRIVHSLAGFKNLHKHGEKE 568

  Fly   123 SNQDLDMIIEEIDADGSGTVDFDEF 147
            :::.....::|:.     .:||:||
  Rat   569 TDKKTSKKMKEMH-----FLDFEEF 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 34/155 (22%)
EFh 14..75 CDD:238008 12/62 (19%)
EFh 90..152 CDD:238008 17/63 (27%)
Efcab12XP_003749858.1 EFh 304..>345 CDD:298682
EF-hand_7 305..>348 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.