DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cabp2a

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001025439.2 Gene:cabp2a / 572226 ZFINID:ZDB-GENE-050913-25 Length:236 Species:Danio rerio


Alignment Length:153 Identity:46/153 - (30%)
Similarity:84/153 - (54%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDF 67
            |.:...|::..|:.||:.||.|..|.|...|:...:..:|..   |....||:...:...|::||
Zfish    88 DRDLRPEEIEELKEAFREFDKDKDGFISCKDLGECMRTMGYM---PTEMELIELSQQICGGRVDF 149

  Fly    68 SQFCKLAA--RFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHEL-DDKLSNQDLDM 129
            ..|..|..  ...|..:.:|.  .||::|||.:|..|.|.:::|.||..:.:| .::|:::::|.
Zfish   150 EDFVDLMGPKMLAETADMIGV--KELRDAFREFDSNGDGQISLAELREAMKKLMGEQLNHREIDE 212

  Fly   130 IIEEIDADGSGTVDFDEFMQVMT 152
            |:.::|.:|.|.|||:||:::|:
Zfish   213 ILRDVDLNGDGLVDFEEFVRMMS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 45/151 (30%)
EFh 14..75 CDD:238008 18/60 (30%)
EFh 90..152 CDD:238008 23/62 (37%)
cabp2aNP_001025439.2 PTZ00184 91..234 CDD:185504 44/147 (30%)
EFh 98..198 CDD:238008 31/104 (30%)
EFh 172..235 CDD:238008 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.