DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CABP4

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_011543483.1 Gene:CABP4 / 57010 HGNCID:1386 Length:295 Species:Homo sapiens


Alignment Length:152 Identity:50/152 - (32%)
Similarity:82/152 - (53%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDF 67
            |.|...|:|..|:.||:.||.|..|.|.|.::...:..||.......:..:.:.:.....|::||
Human   143 DRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMRMGGRVDF 207

  Fly    68 SQFCKLAARFIEVEEDVGAL-QNELKEAFRVYDKEGKGYLTVATLR-GILHELDDKLSNQDLDMI 130
            .:|.:|....:. ||....| ..||:.|||.:|::..|.:|||.|| .:...|.:.|:..:||.:
Human   208 EEFVELIGPKLR-EETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEM 271

  Fly   131 IEEIDADGSGTVDFDEFMQVMT 152
            :.|:|.:|.||||||||:.:::
Human   272 LREVDLNGDGTVDFDEFVMMLS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 50/150 (33%)
EFh 14..75 CDD:238008 16/60 (27%)
EFh 90..152 CDD:238008 27/62 (44%)
CABP4XP_011543483.1 PHA03415 81..>190 CDD:177643 15/46 (33%)
PTZ00184 145..294 CDD:185504 49/150 (33%)
EFh 153..214 CDD:238008 15/60 (25%)
EFh 230..293 CDD:238008 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.