DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cabp7b

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_683885.1 Gene:cabp7b / 556082 ZFINID:ZDB-GENE-060526-366 Length:213 Species:Danio rerio


Alignment Length:71 Identity:24/71 - (33%)
Similarity:46/71 - (64%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFD 145
            |::|    .|::|||:|:|::|.|:::...|...:..|....:..:|::||:.:|.||.|.|||:
Zfish    32 EDEV----EEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFE 92

  Fly   146 EFMQVM 151
            ||:.::
Zfish    93 EFVALL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 24/71 (34%)
EFh 14..75 CDD:238008
EFh 90..152 CDD:238008 22/62 (35%)
cabp7bXP_683885.1 EFh 37..98 CDD:238008 22/60 (37%)
EF-hand_7 38..98 CDD:290234 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.