DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cabp7b

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_683885.1 Gene:cabp7b / 556082 ZFINID:ZDB-GENE-060526-366 Length:213 Species:Danio rerio


Alignment Length:71 Identity:24/71 - (33%)
Similarity:46/71 - (64%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFD 145
            |::|    .|::|||:|:|::|.|:::...|...:..|....:..:|::||:.:|.||.|.|||:
Zfish    32 EDEV----EEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFE 92

  Fly   146 EFMQVM 151
            ||:.::
Zfish    93 EFVALL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 24/71 (34%)
cabp7bXP_683885.1 PTZ00183 28..154 CDD:185503 24/71 (34%)

Return to query results.
Submit another query.