DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and calml4

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001011117.1 Gene:calml4 / 496530 XenbaseID:XB-GENE-5936220 Length:153 Species:Xenopus tropicalis


Alignment Length:145 Identity:36/145 - (24%)
Similarity:75/145 - (51%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            ::.::..:..|..:|..|.|.|...|:.:::..||....|..|...::....|..|::|||.|..
 Frog     7 QDAIQKFKECFSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKDGEVDFSTFLT 71

  Fly    73 LAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDAD 137
            :..|..:.|:.    :||:..|..:.||:.||.:.:..||..|.::.:||:.:::|.:::.:...
 Frog    72 IMYRQQKQEDP----ENEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGVKVG 132

  Fly   138 GSGTVDFDEFMQVMT 152
            ..|.|.::||::.:|
 Frog   133 PDGMVKYEEFVRQIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 35/143 (24%)
EFh 14..75 CDD:238008 16/60 (27%)
EFh 90..152 CDD:238008 16/61 (26%)
calml4NP_001011117.1 PTZ00184 1..144 CDD:185504 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.