DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and MYL4

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_011523141.2 Gene:MYL4 / 4635 HGNCID:7585 Length:228 Species:Homo sapiens


Alignment Length:181 Identity:40/181 - (22%)
Similarity:76/181 - (41%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGEYDKEQLRI----------------------LRNAFKAFDHDGAG--SIEHADVSSILEILGQ 43
            :|||.:..|.:                      .:.||..||....|  .|.:.....:|..|||
Human    54 EGEYGQPHLSVSIALSWRRRRRRKKRRSSCPHEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQ 118

  Fly    44 KLEPPAVKALIKEVDKG-----TTGKLDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGK 103
            .   |....:::.:.|.     ....|||..|..: .:.|...::.|..: :..|..||:|||..
Human   119 N---PTNAEVLRVLGKPKPEEMNVKMLDFETFLPI-LQHISRNKEQGTYE-DFVEGLRVFDKESN 178

  Fly   104 GYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQ-VMTG 153
            |.:..|.||.:|..|.:|::..:::.::.. ..|.:|.::::.|:: :|:|
Human   179 GTVMGAELRHVLATLGEKMTEAEVEQLLAG-QEDANGCINYEAFVKHIMSG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 38/178 (21%)
EFh 14..75 CDD:238008 16/67 (24%)
EFh 90..152 CDD:238008 16/62 (26%)
MYL4XP_011523141.2 EFh_PEF 86..227 CDD:330173 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.