DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and MYL3

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens


Alignment Length:152 Identity:38/152 - (25%)
Similarity:71/152 - (46%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDG--AGSIEHADVSSILEILGQKLEPPAVKALIKEVDKG-----TT 62
            |:..||:...:.||..||...  ...|.:.....:|..|||.   |....:::.:.|.     .|
Human    45 EFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQN---PTQAEVLRVLGKPRQEELNT 106

  Fly    63 GKLDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDL 127
            ..:||..|..: .:.|...:|.|..: :..|..||:||||.|.:..|.||.:|..|.::|:..::
Human   107 KMMDFETFLPM-LQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEV 169

  Fly   128 DMIIEEIDADGSGTVDFDEFMQ 149
            :.::.. ..|.:|.::::.|::
Human   170 EKLMAG-QEDSNGCINYEAFVK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 38/152 (25%)
EFh 14..75 CDD:238008 15/67 (22%)
EFh 90..152 CDD:238008 17/60 (28%)
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 38/152 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.