DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and tnnc1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001004776.1 Gene:tnnc1 / 447990 XenbaseID:XB-GENE-480515 Length:161 Species:Xenopus tropicalis


Alignment Length:147 Identity:42/147 - (28%)
Similarity:81/147 - (55%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGA-GSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFC 71
            :||....|.||..|..|.. |.|...::..::.:|||...|..::.:|.|||:..:|.:||.:|.
 Frog    14 EEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFL 78

  Fly    72 KLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDA 136
            .:..|.:: ::..|..:.||.:.||::||...||:.:..|:.:|....:.::..|::.::.:.|.
 Frog    79 VMMVRCMK-DDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLEATGETITEDDIEELMRDGDK 142

  Fly   137 DGSGTVDFDEFMQVMTG 153
            :..|.:|:|||::.|.|
 Frog   143 NNDGRIDYDEFLEFMKG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 40/144 (28%)
EFh 14..75 CDD:238008 19/61 (31%)
EFh 90..152 CDD:238008 17/61 (28%)
tnnc1NP_001004776.1 PTZ00184 9..157 CDD:185504 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.