DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CG17272

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:147 Identity:40/147 - (27%)
Similarity:75/147 - (51%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDKEQ-LRILRNAFKAFDHDGAGSIEHAD-VSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFS 68
            |.||| :...|..|..|..  :|.|.:.| ::.|:..||..   |.::.|:..: |...||:.|:
  Fly     4 YFKEQDIDEFRECFYLFAR--SGQINNLDELTVIMRSLGLS---PTIQELVSYL-KQKNGKMSFA 62

  Fly    69 QFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEE 133
            .|..:..:..:||    :|.:|:..||:..|.:.||.::...||.:|....:.||.:::|.|..|
  Fly    63 DFLDIMHQHSKVE----SLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFRE 123

  Fly   134 IDADGSGTVDFDEFMQV 150
            .:.:.:.||.:.:|:::
  Fly   124 ANVNNNSTVRYADFVKI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 40/147 (27%)
EFh 14..75 CDD:238008 16/61 (26%)
EFh 90..152 CDD:238008 17/61 (28%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.