DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cabp5a

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_956992.1 Gene:cabp5a / 393671 ZFINID:ZDB-GENE-040426-1655 Length:165 Species:Danio rerio


Alignment Length:152 Identity:43/152 - (28%)
Similarity:84/152 - (55%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDF 67
            |.|...:::..||.||..||.|..|.|...|:.:::..:|.......:..|.:.::....|::||
Zfish    13 DRELADDEIEELREAFNEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELGQNINMNLGGRVDF 77

  Fly    68 SQFCKLAARFIEVEEDVGAL-QNELKEAFRVYDKEGKGYLTVATLRGILHE-LDDKLSNQDLDMI 130
            ..|.:|....: :.|..|.: ..||::||:.:|.:|.|.:|...||..:.: |.:.::.:::|.:
Zfish    78 EDFVELMTPKL-LAETAGMIGVKELRDAFKEFDMDGDGAITTEELRCAMTKLLGEHMNRREIDAV 141

  Fly   131 IEEIDADGSGTVDFDEFMQVMT 152
            :.|.|.:|.|||||:||:::::
Zfish   142 VREADNNGDGTVDFEEFVKMLS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 43/150 (29%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 22/62 (35%)
cabp5aNP_956992.1 PTZ00184 15..164 CDD:185504 42/150 (28%)
EFh 23..85 CDD:238008 17/61 (28%)
EFh 100..163 CDD:238008 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.