DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Cabp5

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001102377.1 Gene:Cabp5 / 365194 RGDID:1308108 Length:173 Species:Rattus norvegicus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:85/147 - (57%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            ::::..||.||..||.|..|.|.:.|:.:::..:|.......:..|.:::.....|::||..|.:
  Rat    27 QDEIDELREAFLEFDKDRDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDFVE 91

  Fly    73 LAARFIEVEEDVGAL-QNELKEAFRVYDKEGKGYLTVATLRGILHE-LDDKLSNQDLDMIIEEID 135
            |....: :.|..|.: ..|:::||:.:|..|.|.:|:|.|:..:.. |.:||:.:::..:::|.|
  Rat    92 LMTPKL-LAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEAD 155

  Fly   136 ADGSGTVDFDEFMQVMT 152
            .:|.|||||:||:::|:
  Rat   156 INGDGTVDFEEFVKMMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 41/145 (28%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 22/62 (35%)
Cabp5NP_001102377.1 PTZ00184 25..171 CDD:185504 41/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.