DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and azot

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:42/144 - (29%)
Similarity:81/144 - (56%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73
            |:..::.:.|:..|.|..|:|...:::.::..||::.....|:::|.|||....|.:...:||.:
  Fly     7 EERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNV 71

  Fly    74 AARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADG 138
            ..|.:.....    ::||:||||::||:..||:|...|:.:...|..|||:.:|:.:|.|.|.|.
  Fly    72 ILRKMRDTNH----EDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQ 132

  Fly   139 SGTVDFDEFMQVMT 152
            ...::::||:.:||
  Fly   133 DNHLNYEEFVNMMT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 40/142 (28%)
EFh 14..75 CDD:238008 15/60 (25%)
EFh 90..152 CDD:238008 23/61 (38%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 42/144 (29%)
EFh 12..72 CDD:238008 15/59 (25%)
EFh 84..146 CDD:238008 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2829
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.