DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and TpnC41C

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:153 Identity:91/153 - (59%)
Similarity:114/153 - (74%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKL 65
            |:| |..|||..:|||||.|||.:..|.|..|.|.:||.:||.:|:...:..:|.|||:..:|::
  Fly     1 MSD-ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQI 64

  Fly    66 DFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMI 130
            :|.:|..|||||: ||||..|:..|||||||:|||||.||:|...||.||.||||||:|.||||:
  Fly    65 EFEEFTTLAARFL-VEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMM 128

  Fly   131 IEEIDADGSGTVDFDEFMQVMTG 153
            |||||:||||||||||||:||||
  Fly   129 IEEIDSDGSGTVDFDEFMEVMTG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 88/150 (59%)
EFh 14..75 CDD:238008 25/60 (42%)
EFh 90..152 CDD:238008 48/61 (79%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 88/150 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ05
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136181at6656
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.