DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and TpnC25D

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:147 Identity:80/147 - (54%)
Similarity:104/147 - (70%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFC 71
            |.|::.|:|.||:.||....|.||...:.:||..:||..:...::|||.:.|...|||::|..||
  Fly     3 DDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFC 67

  Fly    72 KLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDA 136
            .:||.|:| |||..|:|.|||||||:||:||.||:|.:||:.||..||||||:.|||.||.|||.
  Fly    68 SIAAHFLE-EEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDT 131

  Fly   137 DGSGTVDFDEFMQVMTG 153
            ||||||||||||::|.|
  Fly   132 DGSGTVDFDEFMEMMAG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 78/144 (54%)
EFh 14..75 CDD:238008 22/60 (37%)
EFh 90..152 CDD:238008 44/61 (72%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 77/142 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136181at6656
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.