DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and myl1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_956294.1 Gene:myl1 / 336165 ZFINID:ZDB-GENE-030131-8109 Length:190 Species:Danio rerio


Alignment Length:150 Identity:39/150 - (26%)
Similarity:73/150 - (48%) Gaps:11/150 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIK-----EVDKGTTGK 64
            ::.::|:...|.||..||..|...:.:..::.|:..|||.   |..|.:.|     ..|.....:
Zfish    42 DFTQDQMEDYREAFLLFDRVGDSKVAYNQIADIMRALGQN---PTNKEVTKILGNPTADDMVNKR 103

  Fly    65 LDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDM 129
            :||..|..:..  :.:.....|..::..|..||:||||.|.:..|.||.:|..|.:|:|..::|.
Zfish   104 VDFEGFLPMLQ--VVINNPNKATYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMSEAEIDA 166

  Fly   130 IIEEIDADGSGTVDFDEFMQ 149
            :::. ..|.:|.|:::.|::
Zfish   167 LMQG-QEDENGCVNYEAFVK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 39/149 (26%)
EFh 14..75 CDD:238008 17/65 (26%)
EFh 90..152 CDD:238008 20/59 (34%)
myl1NP_956294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
FRQ1 43..189 CDD:227455 39/148 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.