DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CG31960

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:46/148 - (31%)
Similarity:80/148 - (54%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |...|:..:|:|.:...|.|..|:|...::..::..||::.....|:::|.|||....|.:...:
  Fly     3 ELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEE 67

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            ||.:..|.:   .|... :.||::||||:|||..||::...||.:...|.:||.:.:|:.:|.|.
  Fly    68 FCNVILRKM---HDTNK-EEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREY 128

  Fly   135 DADGSGTVDFDEFMQVMT 152
            |.|....::|:||..:||
  Fly   129 DLDQDNHINFEEFTNMMT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 44/146 (30%)
EFh 14..75 CDD:238008 16/60 (27%)
EFh 90..152 CDD:238008 24/61 (39%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 46/148 (31%)
EFh 12..72 CDD:238008 16/59 (27%)
EFh 84..146 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.