DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Mlc-c

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster


Alignment Length:310 Identity:57/310 - (18%)
Similarity:116/310 - (37%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PIFKNV-KVYSVVGGYNLVLGHDKSTIFYDSKGSGCIARCDGRRMR--KINKSS--LAALFGDLE 127
            |::..: |:.||:.  ::.|...:..:.|....||.....:.||.:  ..|::|  |...|.:.|
  Fly   246 PVYDTLWKILSVIA--DVKLDGKRRLVDYHEWDSGLKFSIEKRREKDDTSNRNSRVLRKPFTEKE 308

  Fly   128 VW---------MKNPQLQLDKFSLYAVCDDELTTNLLKKITNVE-----YMFHAKSIYLSV---A 175
            .:         :.|||.:..:.:..|:.|.....||.:| ::|:     |:...:.:.|.|   |
  Fly   309 EYAMYEYVYHKLHNPQTKRIQRNNSALTDALFWKNLCEK-SDVKRNERTYLRRFRDLMLPVLYLA 372

  Fly   176 KFSNVISILSHF---KP---GFLEEIVFFCHSGHESIHEL----FLLEQWKQVKSVFIKWFPFDD 230
            |...::.:..||   :|   .||:|:      ..::|.||    .::...::.|.::.:  .|||
  Fly   373 KIPKLMKMALHFGLEQPVHKNFLQEL------KQDAIVELDNSGCIVAYRERKKRLYSE--AFDD 429

  Fly   231 ---------------------FPFEHLVHVS--CFELNLPRISVSVAIIIRDVLMKTAQFEYGKI 272
                                 .|.:|....|  |..:|:                   ::|...:
  Fly   430 KDEQEVIDLDDDDDEPDPNIQQPDDHTESTSKECASVNV-------------------KYEDNDV 475

  Fly   273 RLYDLNNMDDPPDIEADVVRVFNPNFVDEYVTRPLQFKVEQFLVTIHKRS 322
            :|..::|.||..|:                  :.::..||..::.|.:|:
  Fly   476 KLSLVSNGDDNSDV------------------KEIEDLVEDLILKIPRRN 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 20/97 (21%)
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.