DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CG11638

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:164 Identity:53/164 - (32%)
Similarity:89/164 - (54%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADGE-------YDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVD 58
            :.|||       ..|.|:|..|.||:.||.||.|.|...::.:::..|||......::.:::|:|
  Fly   194 LIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEID 258

  Fly    59 KGTTGKLDFSQFCKLAARFIEVEEDVGAL------QNELKEAFRVYDKEGKGYLTVATLRGILHE 117
            ....|.:.|.:|..:.:..  ..||...|      :.||::||||:||..:||:|.:.||.:|..
  Fly   259 VDGDGNVSFEEFVDILSNM--TYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQC 321

  Fly   118 LDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQVM 151
            |.:.|..:|::.:|:|:|.||.|.:||.||:..:
  Fly   322 LGEDLDEEDIEDMIKEVDVDGDGRIDFYEFVHAL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 53/164 (32%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 27/62 (44%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 17/61 (28%)
EF-hand_7 215..274 CDD:290234 17/58 (29%)
EFh 294..355 CDD:238008 27/60 (45%)
EF-hand_7 295..355 CDD:290234 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.