DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Calml3

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001012054.1 Gene:Calml3 / 307100 RGDID:1305499 Length:149 Species:Rattus norvegicus


Alignment Length:144 Identity:47/144 - (32%)
Similarity:90/144 - (62%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            :||:...:.||..||.||.|.|...::.:::..|||......::.::.|:||...|.:||.:|..
  Rat     7 EEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQDMVNEIDKDGNGTVDFPEFLT 71

  Fly    73 LAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDAD 137
            :.:|.::..:.    :.|::|||||:||:|.|:::.|.||.::..|.:|||::::|.:|:..|.|
  Rat    72 MMSRKMKDTDS----EEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIQAADTD 132

  Fly   138 GSGTVDFDEFMQVM 151
            |.|.|:::||:.::
  Rat   133 GDGQVNYEEFVHML 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 47/144 (33%)
EFh 14..75 CDD:238008 18/60 (30%)
EFh 90..152 CDD:238008 26/62 (42%)
Calml3NP_001012054.1 PTZ00184 1..149 CDD:185504 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.