DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Efcab3

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_038942051.1 Gene:Efcab3 / 303589 RGDID:1305423 Length:6926 Species:Rattus norvegicus


Alignment Length:195 Identity:41/195 - (21%)
Similarity:81/195 - (41%) Gaps:46/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRN--AFKAFDH------------DGAGSIEHADVSSILEILGQKLEPPAVKALIK 55
            |...|.||.|::  .|.|.||            ...|.::..:|.|:||.:|.||.|...|::::
  Rat  3312 EITDEGLRKLQDMLPFDASDHVFQNRMLDAVLSTNEGEVKLGNVDSVLENMGVKLTPKEQKSIMR 3376

  Fly    56 EV---DKGTTGKLDFSQFCKLAARF------------------IEV-EEDVGALQNEL--KEAFR 96
            .:   ::...||:..||..:...:.                  ||: |.:...|::.|  ....:
  Rat  3377 TLLVEEESVDGKIPLSQLMRAVTKVTGGQVNIKDIKSTLEKMGIELTENECSQLESVLPINAKGK 3441

  Fly    97 VYDK--------EGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQVMTG 153
            ||.|        ...|.:.||.:..:|..::.|.::.:::.::|::..|.|..|:....::.:.|
  Rat  3442 VYKKRLLETVVASKSGVVDVANIDTVLQNMEMKFTDTEMEELLEKLPVDDSQKVELRNLIETIEG 3506

  Fly   154  153
              Rat  3507  3506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 40/192 (21%)
EFh 14..75 CDD:238008 19/77 (25%)
EFh 90..152 CDD:238008 13/71 (18%)
Efcab3XP_038942051.1 PTZ00184 155..286 CDD:185504
FRQ1 2048..2234 CDD:227455
FRQ1 2598..2727 CDD:227455
FRQ1 <3833..3932 CDD:227455
FRQ1 <3936..4035 CDD:227455
FRQ1 <4571..4670 CDD:227455
EF-hand_8 6556..6606 CDD:404678
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.