DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Cabp2

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006531826.1 Gene:Cabp2 / 29866 MGIID:1352749 Length:324 Species:Mus musculus


Alignment Length:153 Identity:51/153 - (33%)
Similarity:86/153 - (56%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDF 67
            |.|...|::..|:.||:.||.|..|.|.:.::.:.:..||..   |....||:...:.:.||:||
Mouse   176 DRELRPEEIEELQIAFQEFDRDRDGYIGYRELGACMRTLGYM---PTEMELIEISQQISGGKVDF 237

  Fly    68 SQFCKLAA--RFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHE-LDDKLSNQDLDM 129
            ..|.:|..  ...|..:.:|.  .||::|||.:|..|.|.::|..||..|.. |.::||.:::|.
Mouse   238 EDFVELMGPKLLAETADMIGV--RELRDAFREFDTNGDGCISVGELRAALKALLGERLSQREVDE 300

  Fly   130 IIEEIDADGSGTVDFDEFMQVMT 152
            |:::||.:|.|.|||:||:::|:
Mouse   301 ILQDIDLNGDGLVDFEEFVRMMS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 50/151 (33%)
EFh 14..75 CDD:238008 19/60 (32%)
EFh 90..152 CDD:238008 26/62 (42%)
Cabp2XP_006531826.1 FRQ1 166..324 CDD:227455 51/153 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.