DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and EFCAB9

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001164654.1 Gene:EFCAB9 / 285588 HGNCID:34530 Length:197 Species:Homo sapiens


Alignment Length:82 Identity:19/82 - (23%)
Similarity:37/82 - (45%) Gaps:11/82 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            :|.|:.|.::.          |.|.|.:.|..||..|........||.:.| |....::::.:.:
Human    18 YCLLSVRNVKA----------LAEYFHILDVHGKNTLNDVLFYHFLHHVTD-LKKAQINIVFDML 71

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.:..|.:||::|..::
Human    72 DWNAVGEIDFEKFYMLV 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 19/82 (23%)
EFCAB9NP_001164654.1 FRQ1 29..162 CDD:444056 16/61 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..197
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.