DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CG30378

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:36/148 - (24%)
Similarity:75/148 - (50%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFS 68
            |...:.|:..:|.||..:|.:.:|.:....:..::..||:.|....:..|..|.:....|::.|.
  Fly     3 GSLTEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFK 67

  Fly    69 QFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEE 133
            .|..:.::.:|.:..:..    ||:||:::|:......|:..:|.::..|.:|:|.:||..:.::
  Fly    68 DFLYVMSKRLEEQNSLVC----LKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQD 128

  Fly   134 IDADGSGTVDFDEFMQVM 151
            ||.|..|.:.|:||:..|
  Fly   129 IDQDKDGKISFNEFVTAM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 36/148 (24%)
EFh 14..75 CDD:238008 13/60 (22%)
EFh 90..152 CDD:238008 20/62 (32%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 36/148 (24%)
EFh 12..74 CDD:238008 13/61 (21%)
EFh 86..147 CDD:238008 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.