DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TpnC4 and Efcab7

DIOPT Version :9

Sequence 1:	NP_001163055.1	Gene:	TpnC4 / 35498	FlyBaseID:	FBgn0033027	Length:	153	Species:	Drosophila melanogaster
Sequence 2:	XP_036019895.1	Gene:	Efcab7 / 230500	MGIID:	2385199	Length:	665	Species:	Mus musculus

Alignment Length:	124	Identity:	30/124 - (24%)
Similarity:	44/124 - (35%)	Gaps:	45/124 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 LRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKLAARFI 78
            |..:||..|.:..|:|.|:|:...|...|:|:....|.|:|...|....||.|:.:||||
Mouse   144 LLKSFKKLDVNDDGAILHSDLQKYLTKRGEKMTQEEVNAVINLADINANGKFDYVKFCKL----- 203

  Fly    79 EVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDAD 137
                                      |:|.              |.|.|...:|.::||
Mouse   204 --------------------------YMTT--------------SEQCLKTTLERLEAD 222

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TpnC4	NP_001163055.1	PTZ00184	1..152	CDD:185504	30/124 (24%)
		EFh	14..75	CDD:238008	22/60 (37%)
		EFh	90..152	CDD:238008	8/48 (17%)
Efcab7	XP_036019895.1	FRQ1	<92..205	CDD:227455	22/91 (24%)
Efcab7	XP_036019895.1	EFh	444..504	CDD:415501
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167833856
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930