DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Tnnc2

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_033420.1 Gene:Tnnc2 / 21925 MGIID:98780 Length:160 Species:Mus musculus


Alignment Length:147 Identity:44/147 - (29%)
Similarity:85/147 - (57%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            :|.:...:.||..||.||.|.|...::.:::.:|||......:.|:|:|||:..:|.:||.:|..
Mouse    14 EEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLV 78

  Fly    73 LAARFIEVEEDV-GALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDA 136
            :..|  :::||. |..:.||.|.||::|:...||:....|..|.....:.::.::::.::::.|.
Mouse    79 MMVR--QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTEEEIESLMKDGDK 141

  Fly   137 DGSGTVDFDEFMQVMTG 153
            :..|.:|||||:::|.|
Mouse   142 NNDGRIDFDEFLKMMEG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 42/144 (29%)
EFh 14..75 CDD:238008 20/60 (33%)
EFh 90..152 CDD:238008 17/61 (28%)
Tnnc2NP_033420.1 PTZ00184 12..156 CDD:185504 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.