DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Myl6b

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:150 Identity:40/150 - (26%)
Similarity:81/150 - (54%) Gaps:11/150 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEV-----DKGTTGK 64
            |::|:||...|.||:.||..|.|.|.::....::..|||.   |....::|.:     ::..:.:
Mouse    59 EFNKDQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQN---PTNAEVLKVLGNPKNEELKSRR 120

  Fly    65 LDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDM 129
            :||..|..: .:.:....|.|..::.| |..||:||||.|.:..|.||.:|..|.:|::.::::.
Mouse   121 VDFETFLPM-LQAVAKNRDQGTYEDYL-EGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVET 183

  Fly   130 IIEEIDADGSGTVDFDEFMQ 149
            ::...: |.:|.::::.|::
Mouse   184 VLAGHE-DSNGCINYEAFLK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 40/149 (27%)
Myl6bNP_758463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PTZ00184 57..206 CDD:185504 40/149 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.