DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Myl6b

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:150 Identity:40/150 - (26%)
Similarity:81/150 - (54%) Gaps:11/150 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEV-----DKGTTGK 64
            |::|:||...|.||:.||..|.|.|.::....::..|||.   |....::|.:     ::..:.:
Mouse    59 EFNKDQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQN---PTNAEVLKVLGNPKNEELKSRR 120

  Fly    65 LDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDM 129
            :||..|..: .:.:....|.|..::.| |..||:||||.|.:..|.||.:|..|.:|::.::::.
Mouse   121 VDFETFLPM-LQAVAKNRDQGTYEDYL-EGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVET 183

  Fly   130 IIEEIDADGSGTVDFDEFMQ 149
            ::...: |.:|.::::.|::
Mouse   184 VLAGHE-DSNGCINYEAFLK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 40/149 (27%)
EFh 14..75 CDD:238008 16/65 (25%)
EFh 90..152 CDD:238008 18/59 (31%)
Myl6bNP_758463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PTZ00184 57..206 CDD:185504 40/149 (27%)
EFh 67..131 CDD:298682 16/67 (24%)
EFh 67..95 CDD:197492 8/27 (30%)
EFh 150..204 CDD:238008 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.