DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and C50C3.5

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_498786.3 Gene:C50C3.5 / 183642 WormBaseID:WBGene00016801 Length:189 Species:Caenorhabditis elegans


Alignment Length:150 Identity:35/150 - (23%)
Similarity:72/150 - (48%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |..|:::..:...|:..|.||:|:|..::|:.:|..||..:.|..|:|:::..|....|::||.:
 Worm    43 EVSKQEVEKVFKIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEE 107

  Fly    70 FCKLAA-----RFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHE-LDDKLSNQDLD 128
            |  |||     :...|:.||..:.:::       |...:..::...|.....| :...::.::..
 Worm   108 F--LAAVTSKIKLSTVKADVQLMLSKI-------DNNPEKVISAEELVVAWSETVSTNITVKEAC 163

  Fly   129 MIIEEIDADGSGTVDFDEFM 148
            .:|::.|..|.|.....||:
 Worm   164 ALIQQADTQGRGKATIHEFI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 35/149 (23%)
EFh 14..75 CDD:238008 19/60 (32%)
EFh 90..152 CDD:238008 9/59 (15%)
C50C3.5NP_498786.3 FRQ1 35..186 CDD:227455 35/149 (23%)
EFh 51..113 CDD:238008 21/63 (33%)
EFh 96..150 CDD:298682 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29025
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.