DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cmd-1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_503386.1 Gene:cmd-1 / 178614 WormBaseID:WBGene00000552 Length:149 Species:Caenorhabditis elegans


Alignment Length:152 Identity:54/152 - (35%)
Similarity:95/152 - (62%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKL 65
            ||| :..:||:...:.||..||.||.|:|...::.:::..|||......::.:|.|||....|.:
 Worm     1 MAD-QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64

  Fly    66 DFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMI 130
            ||.:|..:.||.::..:.    :.|::|||||:||:|.|:::.|.||.::..|.:||:::::|.:
 Worm    65 DFPEFLTMMARKMKDTDS----EEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEM 125

  Fly   131 IEEIDADGSGTVDFDEFMQVMT 152
            |.|.|.||.|.|:::||:.:||
 Worm   126 IREADIDGDGQVNYEEFVTMMT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 52/150 (35%)
EFh 14..75 CDD:238008 19/60 (32%)
EFh 90..152 CDD:238008 26/61 (43%)
cmd-1NP_503386.1 PTZ00184 1..149 CDD:185504 54/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.