DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and cal-4

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001379504.1 Gene:cal-4 / 177945 WormBaseID:WBGene00000288 Length:236 Species:Caenorhabditis elegans


Alignment Length:147 Identity:45/147 - (30%)
Similarity:81/147 - (55%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |:..|:|:....|||.||.||..::...::...:.:||.......:..::.|.|....||:||.:
 Worm    70 EFTPEELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGE 134

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |||: .:.:..|.|    |..::.||:|:||:|.||:|....:..:..:.::.|.:::|.||.|:
 Worm   135 FCKM-MKEMNKETD----QELIRLAFKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDEIIREV 194

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.||...:|.|||:.::
 Worm   195 DKDGDEQIDLDEFVNMV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 45/147 (31%)
EFh 14..75 CDD:238008 18/60 (30%)
EFh 90..152 CDD:238008 21/62 (34%)
cal-4NP_001379504.1 PTZ00184 68..211 CDD:185504 45/145 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.