DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and tnc-2

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_496251.1 Gene:tnc-2 / 174612 WormBaseID:WBGene00006583 Length:160 Species:Caenorhabditis elegans


Alignment Length:145 Identity:70/145 - (48%)
Similarity:95/145 - (65%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73
            :|:...|..|..||.:|.|.|....|..||..:||..|...:|.||||.|...:|:::|.:|..:
 Worm    15 DQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFEEFAAM 79

  Fly    74 AARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADG 138
            .|.|:...|:...|:.||:||||:|||||.||:.|:.||.||..|||.:|.::||.:|.||||||
 Worm    80 VANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEIDADG 144

  Fly   139 SGTVDFDEFMQVMTG 153
            ||||||||||::|:|
 Worm   145 SGTVDFDEFMEMMSG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 68/142 (48%)
EFh 14..75 CDD:238008 22/60 (37%)
EFh 90..152 CDD:238008 41/61 (67%)
tnc-2NP_496251.1 PTZ00184 10..157 CDD:185504 68/141 (48%)
EFh 19..81 CDD:238008 22/61 (36%)
EFh 96..158 CDD:238008 41/61 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559697at33208
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.