DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CABP7

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_872333.1 Gene:CABP7 / 164633 HGNCID:20834 Length:215 Species:Homo sapiens


Alignment Length:224 Identity:41/224 - (18%)
Similarity:78/224 - (34%) Gaps:77/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VNRKLRNFVDNKKPIFKNVKVYSVVGGYNLVLGHDKSTIF----YDSKGSGCIARCDGRRMRKIN 115
            |.|....|:|.||        |::....||.|..|..::.    |.::..      :|.:.:.:|
Human   424 VFRDTSYFIDWKK--------YNLFMVPNLDLNLDTQSVLPDVNYKAESP------EGNQSQNMN 474

  Fly   116 KSS---LAALFGDLE---------VWMKNPQLQLDKFSLYAVCDDELTTNLLKKITNVEYMFH-- 166
            ...   |..||.|.:         :|..:..|.....::.:.....:..::...:..|..::|  
Human   475 AQGPALLLFLFVDFQSDVPVQQAKIWGLHTLLTAHLSAILSESRSTVQQSIQSAVDQVWQLYHHD 539

  Fly   167 AKS-----IYLSVAKFSNVISIL-----SHFKPGFLEEIVFFCHSGHES---------IHELFLL 212
            ||:     ..|||| .::::|:|     |.|:...|:.:        |:         :|.:|  
Human   540 AKTQQRLQASLSVA-VNSIMSVLTGSTRSSFRKTCLQAL--------EAADTQEFGVKLHRIF-- 593

  Fly   213 EQWKQVKSVFIKWFPFDDFPFEHLVHVSC 241
                           :|....:.|.|.||
Human   594 ---------------YDITQHQFLKHCSC 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 20/112 (18%)
CABP7NP_872333.1 PTZ00184 27..>102 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.