DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CALML6

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:145 Identity:44/145 - (30%)
Similarity:84/145 - (57%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCKL 73
            ||::..:..|:.||.:|.|.::..::..::.:||.......:.::.|:||:...|..:...|..|
Human    55 EQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLAL 119

  Fly    74 AARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADG 138
            ...:.|..::   .::||:.||||:|||||||:...||:.:|....:.|:..:.:.:::|.|.||
Human   120 MGVYHEKAQN---QESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDG 181

  Fly   139 SGTVDFDEFMQVMTG 153
            ..|:|::||:.:|||
Human   182 DRTIDYEEFVAMMTG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 41/142 (29%)
EFh 14..75 CDD:238008 13/60 (22%)
EFh 90..152 CDD:238008 25/61 (41%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 41/142 (29%)
EFh 59..120 CDD:238008 12/60 (20%)
EFh 133..195 CDD:238008 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.