DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and EFCAB3

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001138405.1 Gene:EFCAB3 / 146779 HGNCID:26379 Length:490 Species:Homo sapiens


Alignment Length:159 Identity:37/159 - (23%)
Similarity:70/159 - (44%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DGAGSIEHADVSSILEILGQKLEPPAVKALIK-----EVDKGTTG---------KLDFSQFCKLA 74
            :|.|.|   :|:||:|.| :|.:|..:..|.|     ::....||         ||..:...|:.
Human    11 NGNGKI---NVNSIMEGL-KKFKPKGMVTLHKLKTANDIKDRVTGHMAVSEIKPKLKLNPLTKVP 71

  Fly    75 ARFIEVEEDV-GALQNEL---------------KEAFRVYDKEGKGYLTVATLRGILHELDDKLS 123
            ....:.:.|: |:||.:|               ::|:..:.|:..|.:....|...:.:|...|:
Human    72 ISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLT 136

  Fly   124 NQDLDMIIEEIDADGSGTVDFDEFMQVMT 152
            ..|:...::..|.|..|.|:|.:|::|:|
Human   137 KHDVYNELKCADIDRDGKVNFSDFIKVLT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 36/157 (23%)
EFh 14..75 CDD:238008 17/64 (27%)
EFh 90..152 CDD:238008 15/76 (20%)
EFCAB3NP_001138405.1 EF-hand_8 115..167 CDD:290545 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.