DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Calm1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001300863.1 Gene:Calm1 / 12313 MGIID:88251 Length:197 Species:Mus musculus


Alignment Length:145 Identity:53/145 - (36%)
Similarity:92/145 - (63%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            :||:...:.||..||.||.|:|...::.:::..|||......::.:|.|||....|.:||.:|..
Mouse    55 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 119

  Fly    73 LAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDAD 137
            :.||.::..:.    :.|::|||||:||:|.||::.|.||.::..|.:||:::::|.:|.|.|.|
Mouse   120 MMARKMKDTDS----EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID 180

  Fly   138 GSGTVDFDEFMQVMT 152
            |.|.|:::||:|:||
Mouse   181 GDGQVNYEEFVQMMT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 51/143 (36%)
EFh 14..75 CDD:238008 19/60 (32%)
EFh 90..152 CDD:238008 28/61 (46%)
Calm1NP_001300863.1 PTZ00184 50..197 CDD:185504 53/145 (37%)
EFh 60..122 CDD:238008 19/61 (31%)
EFh 133..195 CDD:238008 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.