DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CETN2

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_004335.1 Gene:CETN2 / 1069 HGNCID:1867 Length:172 Species:Homo sapiens


Alignment Length:147 Identity:46/147 - (31%)
Similarity:86/147 - (58%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |..:||.:.:|.||..||.||.|:|:..::...:..||.:.:...:|.:|.|:||..|||::|..
Human    24 ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGD 88

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |..:..:.:. |:|.   :.|:.:||:::|.:..|.::...|:.:..||.:.|::::|..:|:|.
Human    89 FLTVMTQKMS-EKDT---KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEA 149

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.||.|.|...||:::|
Human   150 DRDGDGEVSEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 46/147 (31%)
EFh 14..75 CDD:238008 21/60 (35%)
EFh 90..152 CDD:238008 20/62 (32%)
CETN2NP_004335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 2/5 (40%)