DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and si:cabz01076231.1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_021333321.1 Gene:si:cabz01076231.1 / 101886622 ZFINID:ZDB-GENE-160728-151 Length:218 Species:Danio rerio


Alignment Length:151 Identity:44/151 - (29%)
Similarity:84/151 - (55%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |..:.:|..|..|||.||:|..|.:.:.|::..:..:|.......:..:|:::.....|.:||..
Zfish    68 ELSQPELDELAEAFKEFDYDQDGYLNYKDLAECMRTMGYMPTEMELLEIIQQIKMRLGGLMDFDD 132

  Fly    70 FCKLAA--RFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLR-GILHELDDKLSNQDLDMII 131
            ||:|..  ..:|..:.:|.  .|:|.:|..:|.:|.|.::|..:: .:.:.|.:||...:|:.|:
Zfish   133 FCELMGPRMMVETADMLGL--KEIKSSFCQFDTDGDGKISVDEMKEAVKNLLGEKLKKGELEEIL 195

  Fly   132 EEIDADGSGTVDFDEFMQVMT 152
            :|:|.:|.||||||||:.:::
Zfish   196 KELDLNGDGTVDFDEFVMMLS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 44/149 (30%)
EFh 14..75 CDD:238008 17/60 (28%)
EFh 90..152 CDD:238008 23/62 (37%)
si:cabz01076231.1XP_021333321.1 EFh_PEF 68..215 CDD:330173 44/148 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.