DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and LOC100493285

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_002936019.3 Gene:LOC100493285 / 100493285 -ID:- Length:214 Species:Xenopus tropicalis


Alignment Length:147 Identity:42/147 - (28%)
Similarity:74/147 - (50%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |.:.::||::   ||..|.:..|.:...:|.|.||::|..:.....:.:.|.:|. ..|.|.|..
 Frog    69 EQESKELRLV---FKCVDVNKKGFLNANEVQSALELMGFVINKHGEEHIKKWMDL-NKGSLGFCG 129

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |.:|.|.:..|..|   ..||||:.|.:.|::..|.::::.|..........||.|:|:.::.|.
 Frog   130 FQELVADWHGVTRD---FYNELKKGFSLIDQDKDGKISMSDLNAASKMAGIHLSRQELEEMMAEA 191

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.:|...||..||:::|
 Frog   192 DQNGDRAVDISEFIEIM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 42/147 (29%)
EFh 14..75 CDD:238008 16/60 (27%)
EFh 90..152 CDD:238008 19/62 (31%)
LOC100493285XP_002936019.3 PTZ00183 68..214 CDD:185503 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.