DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30440 and ARHGEF40

DIOPT Version :9

Sequence 1:NP_610172.1 Gene:CG30440 / 35496 FlyBaseID:FBgn0050440 Length:1057 Species:Drosophila melanogaster
Sequence 2:XP_011535239.1 Gene:ARHGEF40 / 55701 HGNCID:25516 Length:1523 Species:Homo sapiens


Alignment Length:460 Identity:113/460 - (24%)
Similarity:187/460 - (40%) Gaps:120/460 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 CSGSFCDDDGCSYLDEGLSVDIKSKN-------VQSLHESGT---DEKLS-RKTILLARTEDTND 578
            ||.:.|.:|   |.:||..:..:::.       ::.|..:.|   |...| |:.:||.|.... |
Human  1007 CSLAPCGED---YEEEGPELAPEAEGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRARGP-D 1067

  Fly   579 VTQGISDGTTYFTGSLNITHLPKSNEIFKKPQDPEMQRHR----RGHILKELFETEKIYVNEIAS 639
            ...|:  ||                        |.|:|.|    :..::.||...|:.||..:: 
Human  1068 GPWGV--GT------------------------PRMERKRSISAQQRLVSELIACEQDYVATLS- 1105

  Fly   640 ILKGYYDRLKSDESAP-------ASLQGKANVLFGNLNEIYSFHNDVFLKDLENCISVTERVALC 697
                        |..|       ..|:|...........:.|||...||::|:.|.:...|:..|
Human  1106 ------------EPVPPPGPELTPELRGTWAAALSARERLRSFHRTHFLRELQGCATHPLRIGAC 1158

  Fly   698 FVKRRDKFYQLYSFYCQNIQRSEKLRETLVDTHMFFKECQIGLGHKLPL-------GAY----LL 751
            |::..|:|    |.|.|.::...||..              ||....||       |.|    |.
Human  1159 FLRHGDQF----SLYAQYVKHRHKLEN--------------GLAALSPLSKGSMEAGPYLPRALQ 1205

  Fly   752 KPVQRITKYQLLLKDLLLFTD---NDSCRNELKNALDCMLIVLK----CVNDSMHQISITGFSGD 809
            :|::::|:|..||::||....   :..||     ||...:.:|:    ...|.:...::.|...|
Human  1206 QPLEQLTRYGRLLEELLREAGPELSSECR-----ALGAAVQLLREQEARGRDLLAVEAVRGCEID 1265

  Fly   810 LAKQGELLMQDSFQVWIESKKDIRLRMKPKRRHIFLYQKSLLLCKQTSKSGYNKSSYQFKSDVKM 874
            |.:||:||.:|.|.|....||.:        ||:||::..||..|.....| ....:.:|...|.
Human  1266 LKEQGQLLHRDPFTVICGRKKCL--------RHVFLFEHLLLFSKLKGPEG-GSEMFVYKQAFKT 1321

  Fly   875 SQIGLTESVSGDAKRFEVWLKGR--QEVYTLQASTIGVKEMWVAEIKRVLFNQL---EKLKGDQI 934
            :.:||||::......||:|.:.|  :|.|||||::..:|..|.:.|.::|:.|.   ::|:..|:
Human  1322 ADMGLTENIGDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELRVQQM 1386

  Fly   935 ARYNI 939
            ....|
Human  1387 VSMGI 1391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30440NP_610172.1 RhoGEF 622..796 CDD:214619 45/198 (23%)
PH-like 802..925 CDD:302622 40/124 (32%)
PH 829..922 CDD:278594 29/94 (31%)
ARHGEF40XP_011535239.1 SPEC 786..964 CDD:295325
RhoGEF 1086..1245 CDD:295373 45/194 (23%)
PH_puratrophin-1 1244..1379 CDD:270062 42/143 (29%)
PH 1269..1367 CDD:278594 35/106 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.