DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and HEPH

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_620074.3 Gene:HEPH / 9843 HGNCID:4866 Length:1212 Species:Homo sapiens


Alignment Length:640 Identity:117/640 - (18%)
Similarity:187/640 - (29%) Gaps:255/640 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VLADGVERGILTANRM--IPG------PSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQY 283
            :|::.:| |...:|||  |.|      |.:.:|:.|               |:.||.:.......
Human   660 LLSEDIE-GFQDSNRMHAINGFLFSNLPRLDMCKGD---------------TVAWHLLGLGTETD 708

  Fly   284 YDGVPFVTQCPIQQGNTFRYQWTGNAGTHFWHAHTGLQKLDGLYGSVVVRQPPSRDPNSHLYDFD 348
            ..||.|       ||||.:.|.. ..|......||.:         :.:.||      .:|..|:
Human   709 VHGVMF-------QGNTVQLQGM-RKGAAMLFPHTFV---------MAIMQP------DNLGTFE 750

  Fly   349 LTTHIMLISDWLHEDAAERYPGRLAV-NTGQDPESMLINGKGQFRDPNTGFMTNTPLEIFTITPG 412
            :..          :..:.|..|..|: |..|.|...                         .||.
Human   751 IYC----------QAGSHREAGMRAIYNVSQCPGHQ-------------------------ATPR 780

  Fly   413 RRYRFRMINAFAS------VCP---------AQVTIEGHGMTVIAT-DGEPVHPVDVNTIISFSG 461
            :||:...|....:      .||         .|...:.:|...::. ||             ..|
Human   781 QRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDG-------------LLG 832

  Fly   462 ERYDFVISADQPVGAYWIQLRGLGECGIRRAQQLAIL-----------------RYARGPYQ--- 506
            .||...:..:...|.:.|.....|.     .:.|.||                 ..|..||.   
Human   833 SRYKKAVFREYTDGTFRIPRPRTGP-----EEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHA 892

  Fly   507 ----------PASSPP----TYDVGIPQGVILNPLDAICDR----KRAD-------------AVC 540
                      |.::.|    ||...||:.....|.|:.|..    ...|             |:|
Human   893 HGVLESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAIC 957

  Fly   541 VSNLKNAKKVDKGVL--------VERPDVKIFLPFRFFVYEPKALFIPNTYNRFLVVPSGDHLTS 597
                      .||:|        ::|....:||.|.    |.|:.:                   
Human   958 ----------QKGILEPHGGRSDMDREFALLFLIFD----ENKSWY------------------- 989

  Fly   598 LVDEISYISPPAPPLSQIDDIPPEYFCNGDNRPPNCGPNCECTHMVDIPLGAIVEVVLVDEVQQV 662
            |.:.::......|....:.|   |.|...:.           .|.::..|.|.:..:.:.:.::|
Human   990 LEENVATHGSQDPGSINLQD---ETFLESNK-----------MHAINGKLYANLRGLTMYQGERV 1040

  Fly   663 NLSHPFHLHGTAFYVVGLGRSPDKSIKKINLKHALELDQMGMLERHFSKPPLKDTIAVPNNGYVV 727
                       |:|::.:|:..|        .|.:.......|.|: .:....|.:.:....:.|
Human  1041 -----------AWYMLAMGQDVD--------LHTIHFHAESFLYRN-GENYRADVVDLFPGTFEV 1085

  Fly   728 IRFRADNPGYWLFHCHFLFHIVIGMNLIFHI-GTTADLPP-----------VPPR 770
            :...|.|||.||.|||...|:..||..:|.: ..|..|.|           ||||
Human  1086 VEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSRTEHLSPLTVITKETEKAVPPR 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 108/609 (18%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 24/110 (22%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951 26/181 (14%)
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972 33/179 (18%)
HEPHNP_620074.3 CuRO_1_ceruloplasmin 80..262 CDD:259884
CuRO_2_ceruloplasmin 277..417 CDD:259907
CuRO_3_ceruloplasmin 431..626 CDD:259886
CuRO_4_ceruloplasmin 629..772 CDD:259908 33/160 (21%)
CuRO_5_ceruloplasmin 787..959 CDD:259887 31/199 (16%)
Cupredoxin 974..1117 CDD:302766 36/199 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12110
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11709
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R446
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.